PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00944g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 242aa    MW: 26741.8 Da    PI: 4.4113
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00944g00140.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.3e-155092246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                              g++T+eEd +++ +  q G++ W+ Ia+ ++ gRt++++k++w++
  Peaxi162Scf00944g00140.1 50 GAFTEEEDNIILTLYSQIGSR-WSVIAANLQ-GRTDNDVKNHWNT 92
                              89*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-8542IPR009057Homeodomain-like
PROSITE profilePS500906.4943IPR017877Myb-like domain
SuperFamilySSF466891.76E-171290IPR009057Homeodomain-like
PfamPF002491.9E-51442IPR001005SANT/Myb domain
PROSITE profilePS5129422.2844498IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-204598IPR009057Homeodomain-like
SMARTSM007172.3E-134896IPR001005SANT/Myb domain
PfamPF002491.5E-135092IPR001005SANT/Myb domain
CDDcd001671.41E-105192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGRAPCCDKT KVKRGPWSPD EDNTLKNFVE KNGTGGNWIA LPQKADINHG AFTEEEDNII  60
LTLYSQIGSR WSVIAANLQG RTDNDVKNHW NTKLKKKLLA AAEITNISSN YNSVLNHNYC  120
ATESTCFISN TLTSLVEPNL TMSSNLVPAM LNVETSCQFP LPGLMEIQEN GAITTLQEDG  180
NYLMDFSSGI SSTYYDILNG FDFQEKVITA DPNCSSSSCS TLVQQQGYIP DIDQYPFKGV  240
EN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-1314987108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754515e-38HG975451.1 Solanum pennellii chromosome ch12, complete genome.
GenBankHG9755245e-38HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799606.11e-105PREDICTED: transcription factor RAX2-like
RefseqXP_016453189.11e-105PREDICTED: transcription factor RAX2-like
TrEMBLM0ZHL68e-71M0ZHL6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000009322e-70(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2547422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.11e-46MYB family protein